TA344155 DOK5 antibody

Rabbit Polyclonal Anti-DOK5 Antibody

See related secondary antibodies

Search for all "DOK5"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DOK5

Product Description for DOK5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DOK5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DOK5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C20orf180, Docking protein 5, Downstream of tyrosine kinase 5, IRS6, Insulin receptor substrate 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DOK5 antibody: synthetic peptide directed towards the N terminal of human DOK5. Synthetic peptide located within the following region: GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD.
Application WB
Background DOK5 is a member of the DOK family of membrane proteins, which are adapter proteins involved in sigl transduction. It interacts with phosphorylated receptor tyrosine kises to mediate neurite outgrowth and activation of the MAP kise pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP.The protein encoded by this gene is a member of the DOK family of membrane proteins, which are adapter proteins involved in sigl transduction. The encoded protein interacts with phosphorylated receptor tyrosine kises to mediate neurite outgrowth and activation of the MAP kise pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DOK5 (6 products)

Catalog No. Species Pres. Purity   Source  


DOK5 Human Purified
  Abnova Taiwan Corp.


DOK5 Human Purified
  Abnova Taiwan Corp.


DOK5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


DOK5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


DOK5 Human
  Abnova Taiwan Corp.


DOK5 Human
  Abnova Taiwan Corp.

Positive controls for DOK5 (2 products)

Catalog No. Species Pres. Purity   Source  

DOK5 Lysate

Western Blot: DOK5 Lysate [NBL1-09980] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DOK5
  Novus Biologicals Inc.

DOK5 overexpression lysate

DOK5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn