F-MKA1814AF DOT1L antibody

See related secondary antibodies

Search for all "DOT1L"

50 µg / €680.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse DOT1L

F-MKA1814AF

Product Description for DOT1L

Rabbit anti Mouse DOT1L.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for DOT1L

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Germany only
PDF datasheet View Datasheet
Manufacturer Funakoshi Co., Ltd.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q571B8
Immunogen:
GX1988 (GST-fusion protein, 301 amino acids): KLSGLALPDYTRLSPAKIVLRRHLSQDHTGASKAATSEPHPRPEHPKESSLPYQSPGLSNSMKLSPQDPPLASPATSPLTSEKGSEKGVKERAYSSHGETITSLPVSIPLSTVQPNKLPVSIPLASVVLPSRAERARSTPSPVPQPRDSSATLEKQTGASAHGAGGAGAGSRSLAVAPTGFYAGSVAISGALASSPAPLASGMESAVFDESSGPSSLFATMGSRSTPPQHPPLLSQSRNSGPASPAHQLTASPRLSVTTQGSLPDTSKGELPSDPAFSDPESEAKRRIVSAFQLVPAPSSH.
Add. information Shipping conditions: Dry Ice
Storage -20℃
Format
State:
Aff - Purified

Accessory Products

  • LinkedIn