TA338099 DPP2 antibody

Rabbit Polyclonal Anti-DPP7 Antibody

See related secondary antibodies

Search for all "DPP2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human DPP2

Product Description for DPP2

Rabbit anti Bovine, Canine, Human DPP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DPP2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DPP-2, DPP7, DPPII, Dipeptidyl aminopeptidase II, Dipeptidyl peptidase 7, Dipeptidyl-peptidase 2, Dipeptidyl-peptidase II, QPP, Quiescent cell proline dipeptidase
Presentation Purified
Reactivity Bov, Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DPP7 antibody is: synthetic peptide directed towards the middle region of Human DPP7. Synthetic peptide located within the following region: FRQIKDLFLQGAYDTVRWEFGTCQPLSDEKDLTQLFMFARNAFTVLAMMD.
Application WB
Background The protein encoded by this gene is a post-proline cleaving aminopeptidase expressed in quiescent lymphocytes. The resting lymphocytes are maintained through suppression of apoptosis, a state which is disrupted by inhibition of this novel serine protease. The enzyme has strong sequence homology with prolylcarboxypeptidase and is active at both acidic and neutral pH.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DPP2 (4 products)

Catalog No. Species Pres. Purity   Source  


DPP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


DPP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


DPP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


DPP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DPP2 (2 products)

Catalog No. Species Pres. Purity   Source  

DPP2 Lysate

Western Blot: DPP2 Lysate [NBL1-09998] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DPP7
  Novus Biologicals Inc.

DPP7 293T Cell Transient Overexpression Lysate(Denatured)

DPP7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn