H00442523-B01P DPY19L2P4 antibody

See related secondary antibodies

Search for all "DPY19L2P4"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human DPY19L2P4

H00442523-B01P

Product Description for DPY19L2P4

Mouse anti Human DPY19L2P4.
Product is tested for Western blot / Immunoblot.

Properties for DPY19L2P4

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp686L2199, FLJ25893, MGC39769, MGC48509
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
DPY19L2P4 (AAH47471.1, 1 a.a. ~ 148 a.a) full-length human protein.
AA Sequence:
MKKQGVSPKPLQSSRPSQSKRRCGPPPFPPASAPEPEVEEVEKSALGGGRSFRRRIRNVENRKGLELKVVAKTLLL GPFLLVRNSLAQLREEVHELQAWWFPSRTTLDFAVLVAYLHWLHLVKLCENYRHFSHLSSLEREMTFLHQNG
GeneID:
442523
Add. information Mouse polyclonal antibody raised against a full-length human DPY19L2P4 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn