TA333405 DPY19L4 antibody

Rabbit Polyclonal Anti-DPY19L4 Antibody

See related secondary antibodies

Search for all "DPY19L4"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat DPY19L4

Product Description for DPY19L4

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat DPY19L4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DPY19L4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Dpy-19-like protein 4, Protein dpy-19 homolog 4
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z388
Immunogen:
The immunogen for Anti-DPY19L4 Antibody: synthetic peptide directed towards the middle region of human DPY19L4. Synthetic peptide located within the following region: APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR.
GeneID:
286148
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn