discontinued

H00001807-M01 DPYS antibody

See related secondary antibodies

Search for all "DPYS"

Quick Overview

Mouse anti Human DPYS 3B1

Product Description for DPYS

Mouse anti Human DPYS 3B1.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Properties for DPYS

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DHP, DHPase, Dihydropyrimidinase, Dihydropyrimidine amidohydrolase, Hydantoinase
Presentation Purified
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 3B1
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14117
Immunogen:
DPYS (NP_001376, 422 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEV ATLKSRVTKEDATAGTRKQAHP*
GeneID:
1807
Remarks:
Gene Accession: NM_001385
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant DPYS.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1807

Accessory Products

Proteins and/or Positive Controls

Proteins for DPYS (5 products)

Catalog No. Species Pres. Purity   Source  

DPYS

DPYS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DPYS

DPYS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DPYS

DPYS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DPYS

DPYS Human Purified
  Novus Biologicals Inc.

DPYS

DPYS Human Purified
  Novus Biologicals Inc.

Positive controls for DPYS (2 products)

Catalog No. Species Pres. Purity   Source  

DPYS Lysate

Western Blot: DPYS Lysate [NBL1-10008] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DPYS
  Novus Biologicals Inc.

DPYS overexpression lysate

DPYS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn