TA346073 DPYS antibody

Rabbit Polyclonal Anti-DPYS Antibody

See related secondary antibodies

Search for all "DPYS"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DPYS

Product Description for DPYS

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DPYS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DPYS

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms DHP, DHPase, Dihydropyrimidinase, Dihydropyrimidine amidohydrolase, Hydantoinase
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DPYS antibody: synthetic peptide directed towards the N terminal of human DPYS. Synthetic peptide located within the following region: VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID.
Application WB
Background Dihydropyrimidise catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropiote in pyrimidine metabolism. Dihydropyrimidise is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidise catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropiote in pyrimidine metabolism. Dihydropyrimidise is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DPYS (5 products)

Catalog No. Species Pres. Purity   Source  


DPYS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


DPYS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


DPYS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


DPYS Human Purified
  Novus Biologicals Inc.


DPYS Human Purified
  Novus Biologicals Inc.

Positive controls for DPYS (2 products)

Catalog No. Species Pres. Purity   Source  

DPYS Lysate

Western Blot: DPYS Lysate [NBL1-10008] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DPYS
  Novus Biologicals Inc.

DPYS overexpression lysate

DPYS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn