
NBP1-53119 DTX2 antibody

See related secondary antibodies

Search for all "DTX2"

50 µg / €440.00

Quick Overview

Rabbit anti Canine, Human, Zebrafish DTX2

Product Description for DTX2

Rabbit anti Canine, Human, Zebrafish DTX2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for DTX2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Can, Hu, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to DTX2(deltex homolog 2 (Drosophila)) The peptide sequence was selected from the C terminal of DTX2. Peptide sequence EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE.
Background DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 113878

Accessory Products

  • LinkedIn