discontinued

H00113878-B01P DTX2 / RNF58 antibody

See related secondary antibodies

Search for all "DTX2 / RNF58"

Quick Overview

Mouse anti Human DTX2 / RNF58

Product Description for DTX2 / RNF58

Mouse anti Human DTX2 / RNF58.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DTX2 / RNF58

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Deltex2, KIAA1528, RING finger protein 58, deltex-2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UW9
Immunogen:
DTX2 (NP_065943.1, 1 a.a. ~ 622 a.a) full-length human protein.
AA Sequence:
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADPSLAPYI IDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGNQLVDLAPLGYNY TVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQ HPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSGAVSA SLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTSPPASRLASKSHGSVKRLRKM SVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLSAASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLA MYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARG FPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAE LAAQGVTEDCLEQQ
GeneID:
113878
Remarks:
Gene Accession: NM_020892.1
Add. information Mouse polyclonal antibody raised against a full-length human DTX2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 113878

Accessory Products

Proteins and/or Positive Controls

Proteins for DTX2 / RNF58 (3 products)

Catalog No. Species Pres. Purity   Source  

DTX2 / RNF58 (transcript variant 1)

DTX2 / RNF58 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

DTX2 / RNF58 (transcript variant 2)

DTX2 / RNF58 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

DTX2 / RNF58 (transcript variant 3)

DTX2 / RNF58 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for DTX2 / RNF58 (7 products)

Catalog No. Species Pres. Purity   Source  

DTX2 293T Cell Transient Overexpression Lysate(Denatured)

DTX2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DTX2 overexpression lysate

DTX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DTX2 overexpression lysate

DTX2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DTX2 overexpression lysate

DTX2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DTX2 overexpression lysate

DTX2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DTX2 overexpression lysate

DTX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DTX2 overexpression lysate

DTX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn