discontinued

H00064118-B01 DUS1L antibody

See related secondary antibodies

Search for all "DUS1L"

Quick Overview

Mouse anti Human DUS1L

Product Description for DUS1L

Mouse anti Human DUS1L.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DUS1L

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms tRNA-dihydrouridine synthase 1-like
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P1R4
Immunogen:
DUS1L (NP_071439, 1 a.a. ~ 473 a.a) full-length human protein.
AA Sequence:
MPKLQGFEFWSRTLRGARHVVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANYRKENLYCEVCPEDRPL IVQFCANDPEVFVQAALLAQDYCDAIDLNLGCPQMIAKRGHYGAFLQDEWDLLQRMILLAHEKLSVPVTCKIRVFP EIDKTVRYAQMLEKAGCQLLTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLRDTGVQG VMSAEGNLHNPALFEGRSPAVWELAEEYLDIVREHPCPLSYVRAHLFKLWHHTLQVHQELREELAKVKTLEGIAAV SQELKLRCQEEISRQEGAKPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNKQKKQLRNP HKTFDPSLKPKYAKCDQCGNPKGNRCVFSLCRGCCKKRASKETADCPGHGLLFKTKLEKSLAWKEAQPELQEPQPA APGTPGGFSEVMGSALA
GeneID:
64118
Remarks:
Gene Accession: NM_022156
Add. information Mouse polyclonal antibody raised against a full-length human DUS1L protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 64118

Accessory Products

Proteins and/or Positive Controls

Proteins for DUS1L (3 products)

Catalog No. Species Pres. Purity   Source  

DUS1L

DUS1L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

DUS1L

DUS1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DUS1L

DUS1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DUS1L (3 products)

Catalog No. Species Pres. Purity   Source  

DUS1L 293T Cell Transient Overexpression Lysate(Denatured)

DUS1L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DUS1L Lysate

Western Blot: DUS1L Lysate [NBL1-10042] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DUS1L
  Novus Biologicals Inc.

DUS1L overexpression lysate

DUS1L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn