TA345842 DUSP11 antibody

Rabbit Polyclonal Anti-Dusp11 Antibody

See related secondary antibodies

Search for all "DUSP11"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DUSP11

Product Description for DUSP11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DUSP11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DUSP11

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Dual specificity protein phosphatase 11, PIR1, Phosphatase that interacts with RNA/RNP complex 1, RNA/RNP complex-1-interacting phosphatase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-Dusp11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII.
Application WB
Background It has both, R 5'-diphosphatase and 5'-triphosphatase activities, but displays a poor protein-tyrosine phosphatase activity.Dusp11 binds to R. Dusp11 may participate in nuclear mR metabolism.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn