discontinued

H00001785-M01 Dynamin-2 antibody

See related secondary antibodies

Search for all "Dynamin-2"

Quick Overview

Mouse anti Human Dynamin-2 6C9

H00001785-M01

More Views

  • H00001785-M01

Product Description for Dynamin-2

Mouse anti Human Dynamin-2 6C9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Dynamin-2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DNM2, DYN2
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 6C9
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P50570
Immunogen:
DNM2 (AAH54501, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAF IHHELLAYLYSSADQSSLMEESAD
GeneID:
1785
Remarks:
Gene Accession: BC054501
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant DNM2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1785

Accessory Products

Proteins and/or Positive Controls

Proteins for Dynamin-2 (6 products)

Catalog No. Species Pres. Purity   Source  

Dynamin-2 (transcript variant 3)

Dynamin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Dynamin-2 (transcript variant 1)

Dynamin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Dynamin-2

Dynamin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dynamin-2

Dynamin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dynamin-2

Dynamin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Dynamin-2

Dynamin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Dynamin-2 (4 products)

Catalog No. Species Pres. Purity   Source  

DNM2 overexpression lysate

DNM2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DNM2 overexpression lysate

DNM2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DNM2 overexpression lysate

DNM2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

Dynamin 2 Lysate

Western Blot: Dynamin 2 Lysate [NBL1-09968] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DNM2
  Novus Biologicals Inc.
  • LinkedIn