TA338052 DYNC1LI1 antibody

Rabbit Polyclonal Anti-DYNC1LI1 Antibody

See related secondary antibodies

Search for all "DYNC1LI1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DYNC1LI1

Product Description for DYNC1LI1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DYNC1LI1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DYNC1LI1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DNCLI1, Dynein 1 light intermediate chain 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DYNC1LI1 antibody is: synthetic peptide directed towards the C-terminal region of Human DYNC1LI1. Synthetic peptide located within the following region: AEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVA.
Application WB
Background DYNC1LI1 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. DYNC1LI1 may play a role in binding dynein to membranous organelles or chromosomes. DYNC1LI1 is probably involved in the microtubule-dependent transport of pericentrin. DYNC1LI1 is required for progress throuh the spindle assembly checkpoint. The phosphorylated form appears to be involved in the selective removal of MAD1L1 and MAD1L2 but not BUB1B from kinetochores.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DYNC1LI1 (2 products)

Catalog No. Species Pres. Purity   Source  


DYNC1LI1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DYNC1LI1 (full length, N-term HIS tag)

DYNC1LI1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for DYNC1LI1 (1 products)

Catalog No. Species Pres. Purity   Source  

DYNC1LI1 overexpression lysate

DYNC1LI1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn