discontinued

H00001859-M01 DYRK1A antibody

See related secondary antibodies

Search for all "DYRK1A"

Quick Overview

Mouse anti Human, Mouse, Rat DYRK1A 7D10

H00001859-M01

More Views

  • H00001859-M01
  • H00001859-M01
  • H00001859-M01
  • H00001859-M01
  • H00001859-M01

Product Description for DYRK1A

Mouse anti Human, Mouse, Rat DYRK1A 7D10.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for DYRK1A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DYRK, Dual specificity YAK1-related kinase, Dual specificity tyrosine-phosphorylation-regulated kinase 1A, HP86, MNB, MNBH, Protein kinase minibrain homolog
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E, WB
Clonality Monoclonal
Clone 7D10
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13627
Immunogen:
DYRK1A (NP_001387, 674 a.a. ~ 763 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESP MTGVCVQQSPVASS
GeneID:
1859
Remarks:
Gene Accession: NM_001396
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant DYRK1A.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 1859

Accessory Products

Proteins and/or Positive Controls

Proteins for DYRK1A (6 products)

Catalog No. Species Pres. Purity   Source  

DYRK1A (full length, C-term DDK tag, transcript variant 1)

DYRK1A Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

DYRK1A

DYRK1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK1A

DYRK1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK1A

DYRK1A Human
  Abnova Taiwan Corp.

DYRK1A

DYRK1A Human
  Abnova Taiwan Corp.

DYRK1A

DYRK1A Human
  Abnova Taiwan Corp.

Positive controls for DYRK1A (1 products)

Catalog No. Species Pres. Purity   Source  

DYRK1A overexpression lysate

DYRK1A overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn