discontinued

H00009149-D01P DYRK1B antibody

See related secondary antibodies

Search for all "DYRK1B"

Quick Overview

Rabbit anti Human DYRK1B

Product Description for DYRK1B

Rabbit anti Human DYRK1B.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DYRK1B

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Dual specificity tyrosine-phosphorylation-regulated kinase 1B, MIRK, Minibrain-related kinase, Mirk protein kinase
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y463
Immunogen:
DYRK1B (NP_004705.1, 1 a.a. ~ 629 a.a) full-length human protein.
AA Sequence:
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQAPP QDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQA QIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFL ATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILV EMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLG VQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLD TCPSSSTASSISSSGGSSGSSSDNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASA SSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGRPPLPPPDD PATLGPHLGLRGVPQSTAASS
GeneID:
9149
Remarks:
Gene Accession: NM_004714.1
Add. information Rabbit polyclonal antibody raised against a full-length human DYRK1B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9149

Accessory Products

Proteins and/or Positive Controls

Proteins for DYRK1B (6 products)

Catalog No. Species Pres. Purity   Source  

DYRK1B

DYRK1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DYRK1B

DYRK1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DYRK1B

DYRK1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK1B

DYRK1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK1B

DYRK1B Human
  Abnova Taiwan Corp.

DYRK1B

DYRK1B Human
  Abnova Taiwan Corp.

Positive controls for DYRK1B (2 products)

Catalog No. Species Pres. Purity   Source  

DYRK1B 293T Cell Transient Overexpression Lysate(Denatured)

DYRK1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Dyrk1B Lysate

Western Blot: Dyrk1B Lysate [NBL1-10075] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DYRK1B
  Novus Biologicals Inc.
  • LinkedIn