discontinued

H00008445-M01 DYRK2 antibody

See related secondary antibodies

Search for all "DYRK2"

Quick Overview

Mouse anti Human DYRK2 3G5

H00008445-M01

More Views

  • H00008445-M01

Product Description for DYRK2

Mouse anti Human DYRK2 3G5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for DYRK2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Dual specificity tyrosine-phosphorylation-regulated kinase 2
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3G5
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92630
Immunogen:
DYRK2 (AAH05809, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKV KATPMTPEQAMKQYMQKLTAFEHH
GeneID:
8445
Remarks:
Gene Accession: BC005809
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant DYRK2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 8445

Accessory Products

Proteins and/or Positive Controls

Proteins for DYRK2 (6 products)

Catalog No. Species Pres. Purity   Source  

DYRK2

DYRK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK2

DYRK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK2

DYRK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK2

DYRK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DYRK2

DYRK2 Human
  Abnova Taiwan Corp.

DYRK2

DYRK2 Human
  Abnova Taiwan Corp.

Positive controls for DYRK2 (3 products)

Catalog No. Species Pres. Purity   Source  

DYRK2 Lysate

Western Blot: DYRK2 Lysate [NBL1-10076] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DYRK2
  Novus Biologicals Inc.

DYRK2 overexpression lysate

DYRK2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DYRK2 overexpression lysate

DYRK2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn