discontinued

H00084062-D01P Dysbindin antibody

See related secondary antibodies

Search for all "Dysbindin"

Quick Overview

Rabbit anti Human Dysbindin

Product Description for Dysbindin

Rabbit anti Human Dysbindin.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Dysbindin

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DTNBP1, Dystrobrevin-binding protein 1, Hermansky-Pudlak syndrome 7 protein homolog, Hps7-like protein, My031
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96EV8
Immunogen:
DTNBP1 (NP_115498.2, 1 a.a. ~ 351 a.a) full-length human protein.
AA Sequence:
MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELV DSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQS QQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQYLSTGYLQIAERREPIGSM SSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNEITLQVPNPSELRAKPPSSSSTCTD SATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSDS
GeneID:
84062
Remarks:
Gene Accession: NM_032122.3
Add. information Rabbit polyclonal antibody raised against a full-length human DTNBP1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 84062

Accessory Products

Proteins and/or Positive Controls

Proteins for Dysbindin (8 products)

Catalog No. Species Pres. Purity   Source  

Dysbindin (transcript variant 1)

Dysbindin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Dysbindin (1-270, His-tag)

Dysbindin Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €1,000.00
  Acris Antibodies GmbH

Dysbindin (1-270, His-tag)

Dysbindin Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €370.00
  Acris Antibodies GmbH

Dysbindin

Dysbindin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dysbindin

Dysbindin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dysbindin

Dysbindin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dysbindin

Dysbindin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dysbindin

Western Blot: Dysbindin Protein [NBC1-21266] - Human, His-tagged, Recombinant, E.coli Affinity purified
  Novus Biologicals Inc.

Positive controls for Dysbindin (6 products)

Catalog No. Species Pres. Purity   Source  

DTNBP1 293T Cell Transient Overexpression Lysate(Denatured)

DTNBP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DTNBP1 overexpression lysate

DTNBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DTNBP1 overexpression lysate

DTNBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DTNBP1 overexpression lysate

DTNBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Dysbindin Lysate

Western Blot: Dysbindin Lysate [NBL1-10034] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DTNBP1
  Novus Biologicals Inc.

Dysbindin Lysate

Western Blot: Dysbindin Lysate [NBL1-10035] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DTNBP1
  Novus Biologicals Inc.
  • LinkedIn