discontinued

H00001756-D01P Dystrophin / DMD antibody

See related secondary antibodies

Search for all "Dystrophin / DMD"

Quick Overview

Rabbit anti Human Dystrophin / DMD

Product Description for Dystrophin / DMD

Rabbit anti Human Dystrophin / DMD.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Dystrophin / DMD

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P11532
Immunogen:
DMD (NP_004007.1, 1 a.a. ~ 635 a.a) full-length human protein.
AA Sequence:
MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQP MDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFK QVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLP VLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDF AKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEME NSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEY DRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQP QAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVG SLFHMADDLGRAMESLVSVMTDEEGAE
GeneID:
1756
Remarks:
Gene Accession: NM_004016.1
Add. information Rabbit polyclonal antibody raised against a full-length human DMD protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1756

Accessory Products

Proteins and/or Positive Controls

Proteins for Dystrophin / DMD (4 products)

Catalog No. Species Pres. Purity   Source  

Dystrophin / DMD (transcript variant Dp140b)

Dystrophin / DMD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Dystrophin / DMD (transcript variant Dp71ab)

Dystrophin / DMD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Dystrophin / DMD

Dystrophin / DMD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Dystrophin / DMD

Dystrophin / DMD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Dystrophin / DMD (4 products)

Catalog No. Species Pres. Purity   Source  

DMD overexpression lysate

DMD overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DMD overexpression lysate

DMD overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DMD overexpression lysate

DMD overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DMD overexpression lysate

DMD overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn