NBP1-56400 EARS2 antibody

See related secondary antibodies

Search for all "EARS2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human EARS2

Product Description for EARS2

Rabbit anti Human EARS2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for EARS2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA1970, MSE1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to EARS2(glutamyl-tRNA synthetase 2, mitochondrial (putative)) The peptide sequence was selected from the middle region of EARS2. Peptide sequence TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL.
Background EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn