
NBP1-56400 EARS2 antibody

See related secondary antibodies

Search for all "EARS2"

Quick Overview

Rabbit anti Human EARS2

Product Description for EARS2

Rabbit anti Human EARS2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for EARS2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA1970, MSE1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to EARS2(glutamyl-tRNA synthetase 2, mitochondrial (putative)) The peptide sequence was selected from the middle region of EARS2. Peptide sequence TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL.
Background EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn