NBP1-69061 ECE2 antibody

See related secondary antibodies

Search for all "ECE2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat ECE2

NBP1-69061

Product Description for ECE2

Rabbit anti Rat ECE2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ECE2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IE65
Immunogen:
Synthetic peptides corresponding to Ece2 (endothelin-converting enzyme 2) The peptide sequence was selected from the middle region of Ece2. Peptide sequence YMVELGMLLGGQPTSTRAQMQQVLELEIQLATITVPQDQRRDEEKIYHKM.
GeneID:
408243
Background The function of Ece2 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 408243

Accessory Products

  • LinkedIn