discontinued

AP32748SU-N Echistatin antibody

See related secondary antibodies

Search for all "Echistatin"

0.1 ml / €450.00

Quick Overview

Rabbit anti Snake Echistatin

AP32748SU-N

Product Description for Echistatin

Rabbit anti Snake Echistatin.
Presentation: Serum
Product is tested for Western blot / Immunoblot, Enzyme Immunoassay.

Properties for Echistatin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Carinatin, Disintegrin Echistatin-alpha, Disintegrin echistatin-alpha-1, Disintegrin echistatin-alpha-2, Platelet aggregation activation inhibitor
Presentation Serum
Reactivity Snake
Applications E, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P17347
Immunogen:
Echistatin isolated from Echis carinatus venom with the amino acid sequence: ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Application Western blot: 1/10,000.
ELISA: 1/10,000 versus plate coated with immunogen.
Background Echistatin belonds to the class of short (containing 8 cysteines) monomeric disintegrins, with Mr=5.5 kDa. The active site of Echistatin was localized as an RGD sequence and is known to inhibit the αIIbβ3 integrin fibrinogen receptor, as well as the αVβ3 vitronectin receptor and integrin α5β1 fibronectin receptor. Echistatin inhibits ADP-induced platelet aggregation with an IC50=130nM.
Storage Upon receipt, store undiluted (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Shelf life: One year from despatch.
Format
Preservatives:
None
State:
Liquid Serum
Serum
Specificity
Specificity:
This Polyclonal Echistatin Antibody Cat.-No AP32748SU-N is directed against Echistatin isolated from Echis carinatus venom.

Accessory Products

  • LinkedIn