discontinued

H00001937-B01 EEF1G antibody

See related secondary antibodies

Search for all "EEF1G"

Quick Overview

Mouse anti Human EEF1G

H00001937-B01

More Views

  • H00001937-B01

Product Description for EEF1G

Mouse anti Human EEF1G.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for EEF1G

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms EF-1-gamma, EF1G, Elongation factor 1-G, Elongation factor 1-gamma, GIG35, PRO1608, eEF-1B gamma, eukaryotic translation elongation factor 1 gamma
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P26641
Immunogen:
EEF1G (AAH15813, 1 a.a. ~ 438 a.a) full-length human protein.
AA Sequence:
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIA YHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFL VGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKK DTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLS VALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQ ELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK*
GeneID:
1937
Remarks:
Gene Accession: BC015813
Add. information Mouse polyclonal antibody raised against a full-length human EEF1G protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 1937

Accessory Products

Proteins and/or Positive Controls

Proteins for EEF1G (7 products)

Catalog No. Species Pres. Purity   Source  

EEF1G

EEF1G Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

EEF1G (1-437, His-tag)

EEF1G Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

EEF1G (1-437, His-tag)

EEF1G Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

EEF1G

EEF1G Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EEF1G

EEF1G Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EEF1G

EEF1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EEF1G

EEF1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EEF1G (2 products)

Catalog No. Species Pres. Purity   Source  

EEF1G HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

EEF1G HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-EEF1G antibody (H00001937-M01) by Western Blots.
  Abnova Taiwan Corp.

EEF1G Lysate

Western Blot: EEF1G Lysate [NBL1-10127] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EEF1G
  Novus Biologicals Inc.
  • LinkedIn