discontinued

H00001937-M01 EEF1G antibody

See related secondary antibodies

Search for all "EEF1G"

Quick Overview

Mouse anti Human, Mouse, Rat EEF1G 3F11-1A10

H00001937-M01

More Views

  • H00001937-M01
  • H00001937-M01
  • H00001937-M01
  • H00001937-M01
  • H00001937-M01
  • H00001937-M01
  • H00001937-M01
  • H00001937-M01

Product Description for EEF1G

Mouse anti Human, Mouse, Rat EEF1G 3F11-1A10.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for EEF1G

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms EF-1-gamma, EF1G, Elongation factor 1-G, Elongation factor 1-gamma, GIG35, PRO1608, eEF-1B gamma, eukaryotic translation elongation factor 1 gamma
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 3F11-1A10
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P26641
Immunogen:
EEF1G (AAH15813, 1 a.a. ~ 438 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIA YHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFL VGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKK DTPRKEKGSREEKQKPQAERKEEKKAA
GeneID:
1937
Remarks:
Gene Accession: BC015813
Isotype control AM03095PU-N, SM10P (for use in human samples), SM20P (for use in rat samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant EEF1G.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,RNAi-Ab,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 1937

Accessory Products

Proteins and/or Positive Controls

Proteins for EEF1G (7 products)

Catalog No. Species Pres. Purity   Source  

EEF1G

EEF1G Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

EEF1G (1-437, His-tag)

EEF1G Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

EEF1G (1-437, His-tag)

EEF1G Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

EEF1G

EEF1G Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EEF1G

EEF1G Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EEF1G

EEF1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EEF1G

EEF1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EEF1G (2 products)

Catalog No. Species Pres. Purity   Source  

EEF1G HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

EEF1G HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-EEF1G antibody (H00001937-M01) by Western Blots.
  Abnova Taiwan Corp.

EEF1G Lysate

Western Blot: EEF1G Lysate [NBL1-10127] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EEF1G
  Novus Biologicals Inc.
  • LinkedIn