TA346548 EEF1G antibody

Rabbit Polyclonal Anti-EEF1G Antibody

See related secondary antibodies

Search for all "EEF1G"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EEF1G

Product Description for EEF1G

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EEF1G.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EEF1G

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms EF-1-gamma, EF1G, Elongation factor 1-G, Elongation factor 1-gamma, GIG35, PRO1608, eEF-1B gamma, eukaryotic translation elongation factor 1 gamma
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-EEF1G antibody: synthetic peptide directed towards the middle region of human EEF1G. Synthetic peptide located within the following region: RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE.
Application WB
Background This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008].
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for EEF1G (7 products)

Catalog No. Species Pres. Purity   Source  


EEF1G Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

EEF1G (1-437, His-tag)

EEF1G Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

EEF1G (1-437, His-tag)

EEF1G Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH


EEF1G Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


EEF1G Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


EEF1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


EEF1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EEF1G (2 products)

Catalog No. Species Pres. Purity   Source  

EEF1G HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

EEF1G HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-EEF1G antibody (H00001937-M01) by Western Blots.
  Abnova Taiwan Corp.

EEF1G Lysate

Western Blot: EEF1G Lysate [NBL1-10127] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EEF1G
  Novus Biologicals Inc.
  • LinkedIn