discontinued

H00030845-M01 EHD3 antibody

See related secondary antibodies

Search for all "EHD3"

Quick Overview

Mouse anti Human EHD3 4B7

H00030845-M01

More Views

  • H00030845-M01
  • H00030845-M01
  • H00030845-M01
  • H00030845-M01
  • H00030845-M01

Product Description for EHD3

Mouse anti Human EHD3 4B7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for EHD3

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms EH domain-containing protein 3, EHD2, PAST homolog 3, PAST3
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 4B7
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZN3
Immunogen:
EHD3 (NP_055415, 357 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI*
GeneID:
30845
Remarks:
Gene Accession: NM_014600
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant EHD3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 30845

Accessory Products

Proteins and/or Positive Controls

Proteins for EHD3 (3 products)

Catalog No. Species Pres. Purity   Source  

EHD3

EHD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EHD3

EHD3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EHD3

EHD3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for EHD3 (2 products)

Catalog No. Species Pres. Purity   Source  

EHD3 Lysate

Western Blot: EHD3 Lysate [NBL1-10159] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for EHD3.
  Novus Biologicals Inc.

EHD3 overexpression lysate

EHD3 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn