TA337909 EHD3 antibody

Rabbit Polyclonal Anti-Ehd3 Antibody

See related secondary antibodies

Search for all "EHD3"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish EHD3

Product Description for EHD3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish EHD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EHD3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms EH domain-containing protein 3, EHD2, PAST homolog 3, PAST3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-Ehd3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Ehd3. Synthetic peptide located within the following region: EGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVL.
Application WB
Background Mouse homolog is involved in regulating vesicular structure microtubule-dependent movement.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn