TA345865 EIF2B / EIF2S2 antibody

Rabbit Polyclonal Anti-EIF2S2 Antibody

See related secondary antibodies

Search for all "EIF2B / EIF2S2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EIF2B / EIF2S2

Product Description for EIF2B / EIF2S2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EIF2B / EIF2S2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF2B / EIF2S2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta, eIF-2-beta, eIF2-beta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-EIF2S2 antibody: synthetic peptide directed towards the N terminal of human EIF2S2. Synthetic peptide located within the following region: TQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKK.
Application WB
Background Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a terry complex with GTP and initiator tR and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a terry complex with GTP and initiator tR and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF2B / EIF2S2 (5 products)

Catalog No. Species Pres. Purity   Source  


EIF2B / EIF2S2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


EIF2B / EIF2S2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


EIF2B / EIF2S2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


EIF2B / EIF2S2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


EIF2B / EIF2S2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EIF2B / EIF2S2 (1 products)

Catalog No. Species Pres. Purity   Source  

EIF2beta Lysate

Western Blot: EIF2 beta Lysate [NBL1-10187] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for EIF2C3.
  Novus Biologicals Inc.
  • LinkedIn