TA340021 EIF2B1 / EIF2BA antibody

Rabbit Polyclonal Anti-EIF2B1 Antibody

See related secondary antibodies

Search for all "EIF2B1 / EIF2BA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat EIF2B1 / EIF2BA

Product Description for EIF2B1 / EIF2BA

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat EIF2B1 / EIF2BA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF2B1 / EIF2BA

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Translation initiation factor eIF-2B subunit alpha, eIF-2B GDP-GTP exchange factor subunit alpha
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-EIF2B1 antibody: synthetic peptide directed towards the C terminal of human EIF2B1. Synthetic peptide located within the following region: ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL.
Application WB
Background EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF2B1 / EIF2BA (6 products)

Catalog No. Species Pres. Purity   Source  

EIF2B1 / EIF2BA (1-305, His-tag)

EIF2B1 / EIF2BA Human Purified > 90 % E. coli
50 µg / €820.00
  OriGene Technologies GmbH

EIF2B1 / EIF2BA (1-305, His-tag)

EIF2B1 / EIF2BA Human Purified > 90 % E. coli
10 µg / €320.00
  OriGene Technologies GmbH


EIF2B1 / EIF2BA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


EIF2B1 / EIF2BA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


EIF2B1 / EIF2BA Human Purified
  Novus Biologicals Inc.


EIF2B1 / EIF2BA Human Purified
  Novus Biologicals Inc.

Positive controls for EIF2B1 / EIF2BA (1 products)

Catalog No. Species Pres. Purity   Source  

EIF2B1 293T Cell Transient Overexpression Lysate(Denatured)

EIF2B1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn