discontinued

H00008891-B01P EIF2B3 antibody

See related secondary antibodies

Search for all "EIF2B3"

Quick Overview

Mouse anti Human EIF2B3

H00008891-B01P

More Views

  • H00008891-B01P

Product Description for EIF2B3

Mouse anti Human EIF2B3.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for EIF2B3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Translation initiation factor eIF-2B subunit gamma, eIF-2B GDP-GTP exchange factor subunit gamma
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NR50
Immunogen:
EIF2B3 (NP_065098.1, 1 a.a. ~ 452 a.a) full-length human protein.
AA Sequence:
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIV CIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKAV EQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSEL IPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHI MKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCL IKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
GeneID:
8891
Remarks:
Gene Accession: NM_020365.2
Add. information Mouse polyclonal antibody raised against a full-length human EIF2B3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 8891

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF2B3 (4 products)

Catalog No. Species Pres. Purity   Source  

EIF2B3

EIF2B3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EIF2B3

EIF2B3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EIF2B3

EIF2B3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EIF2B3

EIF2B3 Human
  Abnova Taiwan Corp.

Positive controls for EIF2B3 (2 products)

Catalog No. Species Pres. Purity   Source  

EIF2B3 293T Cell Transient Overexpression Lysate(Denatured)

EIF2B3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

EIF2B3 overexpression lysate

EIF2B3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn