TA331249 EIF2B3 antibody

Rabbit Polyclonal Anti-Eif2b3 Antibody

See related secondary antibodies

Search for all "EIF2B3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EIF2B3

Product Description for EIF2B3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EIF2B3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF2B3

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Translation initiation factor eIF-2B subunit gamma, eIF-2B GDP-GTP exchange factor subunit gamma
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Eif2b3 antibody is: synthetic peptide directed towards the middle region of Rat Eif2b3. Synthetic peptide located within the following region: FRAYDASLAMLMRKGQESTEPVPGQKGKKKTVEQRDFIGVDSTGKRLLFM.
Application WB
Background Eif2b3 is a guanine nucleotide exchange factor that regulates key step in protein synthesis; restores eIF2 to its active GTP-bound state.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn