H00027161-M01 EIF2C2 / AGO2 antibody

See related secondary antibodies

Search for all "EIF2C2 / AGO2"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human EIF2C2 / AGO2 2E12-1C9

H00027161-M01

More Views

  • H00027161-M01
  • H00027161-M01
  • H00027161-M01

Product Description for EIF2C2 / AGO2

Mouse anti Human EIF2C2 / AGO2 2E12-1C9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for EIF2C2 / AGO2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Eukaryotic translation initiation factor 2C2, PAZ Piwi domain protein, PPD, Protein argonaute-2, Protein slicer, eIF-2C 2, hAgo-2
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 2E12-1C9
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKV8
Immunogen:
EIF2C2 (AAH07633, 1 a.a. ~ 377 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQ TLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQH RQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKR HHTRLFCTDKNERVGKSGNIPAGTTVD
GeneID:
27161
Remarks:
Gene Accession: BC007633
Application ELISA, IF, IHC-P, RNAi-Ab, S-ELISA, WB-Re.
Background This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
General Readings
  1. Le Guillou S, Marthey S, Laloë D, Laubier J, Mobuchon L, Leroux C, et al. Characterisation and comparison of lactating mouse and bovine mammary gland miRNomes. PLoS One. 2014 Mar 21;9(3):e91938. doi: 10.1371/journal.pone.0091938. eCollection 2014. PubMed PMID: 24658750. (Free PMC Article available, 5 images available)
  2. NMDA receptor-dependent regulation of miRNA expression and association with Argonaute during LTP in vivo. Pai B, Siripornmongcolchai T, Berentsen B, Pakzad A, Vieuille C, Pallesen S, Pajak M, Simpson TI, Armstrong JD, Wibrand K, Bramham CRFront Cell Neurosci. 2014 Jan 13;7:285. doi: 10.3389/fncel.2013.00285. eCollection 2014 Jan 13.
  3. MicroRNA-23 inhibits PRRSV replication by directly targeting PRRSV RNA and possibly by upregulating type I interferons. Zhang Q, Guo XK, Gao L, Huang C, Li N, Jia X, Liue W, Feng WH.Virology 450-451 (2014) 182–195
  4. Fan M, Krutilina R, Sun J, Sethuraman A, Yang CH, Wu ZH, et al. Comprehensive analysis of microRNA (miRNA) targets in breast cancer cells. J Biol Chem. 2013 Sep 20;288(38):27480-93. doi: 10.1074/jbc.M113.491803. Epub 2013 Aug 6. PubMed PMID: 23921383. (Free PMC Article available)
  5. Identification of axon-enriched microRNAs localized in growth cones of cortical neurons. Sasaki Y, Gross C, Xing L, Goshima Y, Bassell GJDev Neurobiol. 2013 Jul 29. doi: 10.1002/dneu.22113.
  6. Remodeling of Ago2-mRNA interactions upon cellular stress reflects miRNA complementarity and correlates with altered translation rates. Karginov FV, Hannon GJGenes Dev. 2013 Jul 3.
  7. Curtale G, Mirolo M, Renzi TA, Rossato M, Bazzoni F, Locati M. Negative regulation of Toll-like receptor 4 signaling by IL-10-dependent microRNA-146b. Proc Natl Acad Sci U S A. 2013 Jul 9;110(28):11499-504. doi: 10.1073/pnas.1219852110. Epub 2013 Jun 24. PubMed PMID: 23798430. (Free PMC Article available, 6 images available)
  8. Single modification at position 14 of siRNA strand abolishes its gene-silencing activity by decreasing both RISC loading and target degradation. Zheng J, Zhang L, Zhang J, Wang X, Ye K, Xi Z, Du Q, Liang ZFASEB J. 2013 Jun 14.
  9. Activated platelets can deliver mRNA regulatory Ago2{middle dot}microRNA complexes to endothelial cells via microparticles. Laffont B, Corduan A, Ple H, Duchez AC, Cloutier N, Boilard E, Provost PBlood. 2013 May 7.
  10. Wei Y, Nazari-Jahantigh M, Chan L, Zhu M, Heyll K, Corbalán-Campos J, et al. The microRNA-342-5p fosters inflammatory macrophage activation through an Akt1- and microRNA-155-dependent pathway during atherosclerosis. Circulation. 2013 Apr 16;127(15):1609-19. doi: 10.1161/CIRCULATIONAHA.112.000736. Epub 2013 Mar 19. PubMed PMID: 23513069.
  11. Loss of miR-125b-1 contributes to head and neck cancer development by dysregulating TACSTD2 and MAPK pathway. Nakanishi H, Taccioli C, Palatini J, Fernandez-Cymering C, Cui R, Kim T, Volinia S, Croce CMOncogene. 2013 Feb 18. doi: 10.1038/onc.2013.13.
  12. Additional expression of microRNA-181 inhibits Porcine Reproductive and Respiratory Syndrome Virus replication and its implications for controlling virus infection. Guo XK, Zhang Q, Gao L, Li N, Chen XX, Feng WH.J Virol. 2012 Nov 14.
  13. Direct Conversion of Fibroblasts to Neurons by Reprogramming PTB-Regulated MicroRNA Circuits. Xue Y, Ouyang K, Huang J, Zhou Y, Ouyang H, Li H, Wang G, Wu Q, Wei C, Bi Y, Jiang L, Cai Z, Sun H, Zhang K, Zhang Y, Chen J, Fu XD.Cell. 2013 Jan 9. pii: S0092-8674(12)01433-X. doi: 10.1016/j.cell.2012.11.045.
  14. Wei N, Zhang L, Huang H, Chen Y, Zheng J, Zhou X, et al. siRNA has greatly elevated mismatch tolerance at 3'-UTR sites. PLoS One. 2012;7(11):e49309. doi: 10.1371/journal.pone.0049309. Epub 2012 Nov 8. PubMed PMID: 23145149. (Free PMC Article available, 5 images available)
  15. The mammalian TRIM-NHL protein TRIM71/LIN-41 is a repressor of mRNA function. Loedige I, Gaidatzis D, Sack R, Meister G, Filipowicz W.Nucleic Acids Res. 2012 Nov 3. [Epub ahead of print]
  16. Nazari-Jahantigh M, Wei Y, Noels H, Akhtar S, Zhou Z, Koenen RR, et al. MicroRNA-155 promotes atherosclerosis by repressing Bcl6 in macrophages. J Clin Invest. 2012 Nov 1;122(11):4190-202. doi: 10.1172/JCI61716. Epub 2012 Oct 8. PubMed PMID: 23041630. (Free PMC Article available, 10 images available)
  17. Tiedje C, Ronkina N, Tehrani M, Dhamija S, Laass K, Holtmann H, et al. The p38/MK2-driven exchange between tristetraprolin and HuR regulates AU-rich element-dependent translation. PLoS Genet. 2012 Sep;8(9):e1002977. doi: 10.1371/journal.pgen.1002977. Epub 2012 Sep 27. PubMed PMID: 23028373. (Free PMC Article available, 7 images available)
  18. Reed JC, Molter B, Geary CD, McNevin J, McElrath J, Giri S, et al. HIV-1 Gag co-opts a cellular complex containing DDX6, a helicase that facilitates capsid assembly. J Cell Biol. 2012 Aug 6;198(3):439-56. doi: 10.1083/jcb.201111012. Epub 2012 Jul 30. PubMed PMID: 22851315. (Free PMC Article available, 10 images available)
  19. Generation of miRNA sponge constructs. Kluiver J, Slezak-Prochazka I, Smigielska-Czepiel K, Halsema N, Kroesen BJ, van den Berg A.Methods. 2012 Jul 23.
  20. MicroRNAs Regulate p21(Waf1/cip1) Protein Expression and the DNA Damage Response in Human Embryonic Stem Cells. Dolezalova D, Mraz M, Barta T, Plevova K, Vinarsky V, Holubcova Z, Jaros J, Dvorak P, Pospisilova S, Hampl A.Stem Cells. 2012 Apr 17. doi: 10.1002/stem.1108.
  21. Bañez-Coronel M, Porta S, Kagerbauer B, Mateu-Huertas E, Pantano L, Ferrer I, et al. A pathogenic mechanism in Huntington's disease involves small CAG-repeated RNAs with neurotoxic activity. PLoS Genet. 2012;8(2):e1002481. doi: 10.1371/journal.pgen.1002481. Epub 2012 Feb 23. PubMed PMID: 22383888. (Free PMC Article available, 7 images available)
  22. Chiang K, Sung TL, Rice AP. Regulation of cyclin T1 and HIV-1 Replication by microRNAs in resting CD4+ T lymphocytes. J Virol. 2012 Mar;86(6):3244-52. doi: 10.1128/JVI.05065-11. Epub 2011 Dec 28. PubMed PMID: 22205749. (Free PMC Article available, 4 images available)
  23. Regulation of human chondrocyte function through direct inhibition of cartilage master-regulator SOX9 by miRNA-145. Martinez-Sanchez A, Dudek KA, Murphy CL.J Biol Chem. 2011 Nov 18.
  24. Cook D, Sanchez-Carbente Mdel R, Lachance C, Radzioch D, Tremblay S, Khandjian EW, et al. Fragile X related protein 1 clusters with ribosomes and messenger RNAs at a subset of dendritic spines in the mouse hippocampus. PLoS One. 2011;6(10):e26120. doi: 10.1371/journal.pone.0026120. Epub 2011 Oct 11. PubMed PMID: 22022532. (Free PMC Article available, 10 images available)
  25. Characterization of extracellular circulating microRNA. Turchinovich A, Weiz L, Langheinz A, Burwinkel B.Nucleic Acids Res. 2011 May 24. [Epub ahead of print]
  26. Lund E, Sheets MD, Imboden SB, Dahlberg JE. Limiting Ago protein restricts RNAi and microRNA biogenesis during early development in Xenopus laevis. Genes Dev. 2011 Jun 1;25(11):1121-31. doi: 10.1101/gad.2038811. Epub 2011 May 16. PubMed PMID: 21576259. (Free PMC Article available, 7 images available)
  27. HuR-dependent loading of miRNA RISC to the mRNA encoding the Ras-related small GTPase RhoB controls its translation during UV-induced apoptosis. Glorian V, Maillot G, Poles S, Iacovoni JS, Favre G, Vagner S.Cell Death Differ. 2011 Apr 29. [Epub ahead of print]
  28. Rawlings RA, Krishnan V, Walter NG. Viral RNAi suppressor reversibly binds siRNA to outcompete Dicer and RISC via multiple turnover. J Mol Biol. 2011 Apr 29;408(2):262-76. doi: 10.1016/j.jmb.2011.02.038. Epub 2011 Feb 24. PubMed PMID: 21354178. (Free PMC Article available, 5 images available)
  29. The QKI-6 RNA Binding Protein Localizes with the MBP mRNAs in Stress Granules of Glial Cells. Wang Y, Lacroix G, Haines J, Doukhanine E, Almazan G, Richard S.PLoS One. 2010 Sep 17;5(9). pii: e12824.
  30. Cheloufi S, Dos Santos CO, Chong MM, Hannon GJ. A dicer-independent miRNA biogenesis pathway that requires Ago catalysis. Nature. 2010 Jun 3;465(7298):584-9. doi: 10.1038/nature09092. PubMed PMID: 20424607. (Free PMC Article available, 5 images available)
  31. Flemr M, Ma J, Schultz RM, Svoboda P. P-body loss is concomitant with formation of a messenger RNA storage domain in mouse oocytes. Biol Reprod. 2010 May;82(5):1008-17. doi: 10.1095/biolreprod.109.082057. Epub 2010 Jan 14. PubMed PMID: 20075394. (Free PMC Article available, 8 images available)
  32. Lin JC, Tarn WY. RNA-binding motif protein 4 translocates to cytoplasmic granules and suppresses translation via argonaute2 during muscle cell differentiation. J Biol Chem. 2009 Dec 11;284(50):34658-65. doi: 10.1074/jbc.M109.032946. Epub 2009 Sep 29. PubMed PMID: 19801630. (Free PMC Article available, 6 images available)
  33. A high throughput experimental approach to identify miRNA targets in human cells. Tan LP, Seinen E, Duns G, de Jong D, Sibon OC, Poppema S, Kroesen BJ, Kok K, van den Berg A.Nucleic Acids Res. 2009 Sep 4. [Epub ahead of print]
  34. Landry P, Plante I, Ouellet DL, Perron MP, Rousseau G, Provost P. Existence of a microRNA pathway in anucleate platelets. Nat Struct Mol Biol. 2009 Sep;16(9):961-6. doi: 10.1038/nsmb.1651. Epub 2009 Aug 9. PubMed PMID: 19668211. (Free PMC Article available, 4 images available)
  35. Zeitelhofer M, Karra D, Macchi P, Tolino M, Thomas S, Schwarz M, et al. Dynamic interaction between P-bodies and transport ribonucleoprotein particles in dendrites of mature hippocampal neurons. J Neurosci. 2008 Jul 23;28(30):7555-62. doi: 10.1523/JNEUROSCI.0104-08.2008. PubMed PMID: 18650333.
  36. Alisch RS, Jin P, Epstein M, Caspary T, Warren ST. Argonaute2 is essential for mammalian gastrulation and proper mesoderm formation. PLoS Genet. 2007 Dec 28;3(12):e227. doi: 10.1371/journal.pgen.0030227. PubMed PMID: 18166081. (Free PMC Article available, 5 images available)
  37. Vickers TA, Lima WF, Nichols JG, Crooke ST. Reduced levels of Ago2 expression result in increased siRNA competition in mammalian cells. Nucleic Acids Res. 2007;35(19):6598-610. Epub 2007 Sep 28. PubMed PMID: 17905815. (Free PMC Article available, 7 images available)
  38. Krol J, Fiszer A, Mykowska A, Sobczak K, de Mezer M, Krzyzosiak WJ. Ribonuclease dicer cleaves triplet repeat hairpins into shorter repeats that silence specific targets. Mol Cell. 2007 Feb 23;25(4):575-86. PubMed PMID: 17317629.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.4
Purity:
Purified
State:
Purified
Specificity
Specificity:
Mouse monoclonal antibody raised against a full length recombinant EIF2C2.
Antibody Reactive Against Recombinant Protein.
Species:
Human
Gene ID 27161

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF2C2 / AGO2 (9 products)

Catalog No. Species Pres. Purity   Source  

EIF2C2 / AGO2 (transcript variant 2)

EIF2C2 / AGO2 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human
2 µg / €300.00
  Abnova Taiwan Corp.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €380.00
  Abnova Taiwan Corp.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €510.00
  Abnova Taiwan Corp.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human Purified
2 µg / €300.00
  Abnova Taiwan Corp.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €380.00
  Abnova Taiwan Corp.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €510.00
  Abnova Taiwan Corp.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €380.00
  Abnova Taiwan Corp.

EIF2C2 / AGO2

EIF2C2 / AGO2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €510.00
  Abnova Taiwan Corp.

Positive controls for EIF2C2 / AGO2 (1 products)

Catalog No. Species Pres. Purity   Source  

Ago2 / eIF2C2 Lysate

Western Blot: Ago2 / eIF2C2 Lysate [NBL1-10183] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EIF2C2
0.1 mg / €620.00
  Novus Biologicals Inc.
  • LinkedIn