TA345851 EIF3B / EIF3S9 antibody

Rabbit Polyclonal Anti-EIF3S9 Antibody

See related secondary antibodies

Search for all "EIF3B / EIF3S9"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish EIF3B / EIF3S9

Product Description for EIF3B / EIF3S9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish EIF3B / EIF3S9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF3B / EIF3S9

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Eukaryotic translation initiation factor 3 subunit 9, Eukaryotic translation initiation factor 3 subunit B, Prt1 homolog, eIF-3-eta, eIF3 p110, eIF3 p116
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55884
Immunogen:
The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9. Synthetic peptide located within the following region: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP.
GeneID:
8662
Application WB
Background EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRi and mR.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF3B / EIF3S9 (2 products)

Catalog No. Species Pres. Purity   Source  

EIF3B / EIF3S9 (transcript variant 2)

EIF3B / EIF3S9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EIF3B / EIF3S9 (transcript variant 1)

EIF3B / EIF3S9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn