discontinued

H00008669-B01 EIF3J / EIF3S1 antibody

See related secondary antibodies

Search for all "EIF3J / EIF3S1"

Quick Overview

Mouse anti Human EIF3J / EIF3S1

Product Description for EIF3J / EIF3S1

Mouse anti Human EIF3J / EIF3S1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for EIF3J / EIF3S1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Eukaryotic translation initiation factor 3 subunit 1, Eukaryotic translation initiation factor 3 subunit J, eIF-3-alpha, eIF3 p35
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75822
Immunogen:
EIF3S1 (NP_003749.2, 1 a.a. ~ 258 a.a) full-length human protein.
AA Sequence:
MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKK IAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSS RDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVP GGGLKATMKDDLADYGGYDGGYVQDYEDFM
GeneID:
8669
Remarks:
Gene Accession: NM_003758.2
Add. information Mouse polyclonal antibody raised against a full-length human EIF3S1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 8669

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF3J / EIF3S1 (6 products)

Catalog No. Species Pres. Purity   Source  

EIF3J / EIF3S1 (70-258, His-tag)

EIF3J / EIF3S1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €940.00
  OriGene Technologies GmbH

EIF3J / EIF3S1 (70-258, His-tag)

EIF3J / EIF3S1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €370.00
  OriGene Technologies GmbH

EIF3J / EIF3S1

EIF3J / EIF3S1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EIF3J / EIF3S1

EIF3J / EIF3S1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EIF3J / EIF3S1

EIF3J / EIF3S1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF3J / EIF3S1

EIF3J / EIF3S1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for EIF3J / EIF3S1 (2 products)

Catalog No. Species Pres. Purity   Source  

EIF3J Lysate

EIF3J Lysate
  Novus Biologicals Inc.

EIF3S1 293T Cell Transient Overexpression Lysate(Denatured)

EIF3S1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn