discontinued

H00009470-M02 EIF4E2 / EIF4EL3 antibody

See related secondary antibodies

Search for all "EIF4E2 / EIF4EL3"

Quick Overview

Mouse anti Human EIF4E2 / EIF4EL3 1A11

Product Description for EIF4E2 / EIF4EL3

Mouse anti Human EIF4E2 / EIF4EL3 1A11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for EIF4E2 / EIF4EL3

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Eukaryotic translation initiation factor 4E homologous protein, Eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E-like 3, eIF-4E type 2, eIF4E type 2, eIF4E-like protein 4E-LP, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1A11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O60573
Immunogen:
EIF4E2 (NP_004837, 146 a.a. ~ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSI KMPGRLGPQRLLFQNLWKPRLNVP*
GeneID:
9470
Remarks:
Gene Accession: NM_004846
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant EIF4E2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9470

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF4E2 / EIF4EL3 (8 products)

Catalog No. Species Pres. Purity   Source  

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human in vitro transl.
  Abnova Taiwan Corp.

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human Purified
  Abnova Taiwan Corp.

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF4E2 / EIF4EL3

EIF4E2 / EIF4EL3 Human
  Abnova Taiwan Corp.

Positive controls for EIF4E2 / EIF4EL3 (2 products)

Catalog No. Species Pres. Purity   Source  

EIF4E2 293T Cell Transient Overexpression Lysate(Denatured)

EIF4E2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

EIF4E2 Lysate

Western Blot: EIF4E2 Lysate [NBL1-10205] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EIF4E2
  Novus Biologicals Inc.
  • LinkedIn