discontinued

H00010136-D01 Elastase-3A antibody

See related secondary antibodies

Search for all "Elastase-3A"

Quick Overview

Rabbit anti Human Elastase-3A

H00010136-D01

More Views

  • H00010136-D01
  • H00010136-D01

Product Description for Elastase-3A

Rabbit anti Human Elastase-3A.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation, Western blot / Immunoblot.

Properties for Elastase-3A

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CELA3A, Chymotrypsin-like elastase family member 3A, ELA3, ELA3A, Elastase IIIA, Protease E, pancreatic Elastase 3A
Presentation Serum
Reactivity Hu
Applications E(detection), IP, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P09093
Immunogen:
ELA3A (NP_005738.3, 1 a.a. ~ 270 a.a) full-length human protein.
AA Sequence:
MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCIS RDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILP NKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDG GWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH
GeneID:
10136
Remarks:
Gene Accession: NM_005747.3
Add. information Rabbit polyclonal antibody raised against a full-length human ELA3A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10136

Accessory Products

Proteins and/or Positive Controls

Proteins for Elastase-3A (2 products)

Catalog No. Species Pres. Purity   Source  

Elastase-3A

Elastase-3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Elastase-3A

Elastase-3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Elastase-3A (3 products)

Catalog No. Species Pres. Purity   Source  

CELA3A overexpression lysate

CELA3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ELA3A 293T Cell Transient Overexpression Lysate(Denatured)

ELA3A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ELA3A Lysate

Western Blot: ELA3A Lysate [NBL1-10220] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CELA3A
  Novus Biologicals Inc.
  • LinkedIn