TA330169 ELK4 antibody

Rabbit Polyclonal Anti-ELK4 Antibody

See related secondary antibodies

Search for all "ELK4"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ELK4

Product Description for ELK4

Rabbit anti Human ELK4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ELK4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ETS domain-containing protein Elk-4, SAP1, SRF accessory protein 1, Serum response factor accessory protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptide directed towards the C terminal of human ELK4. Synthetic peptide located within the following region: FSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM.
Application WB
Background The ELK4 gene is a member of the Ets family of transcription factors and of the terry complex factor (TCF) subfamily. Proteins of the TCF subfamily form a terry complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kises, MAPK1 and MAPK8.This gene is a member of the Ets family of transcription factors and of the terry complex factor (TCF) subfamily. Proteins of the TCF subfamily form a terry complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kises, MAPK1 and MAPK8. Several transcript variants have been described for this gene.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ELK4 (6 products)

Catalog No. Species Pres. Purity   Source  

ELK4 (transcript variant b)

ELK4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

ELK4 (full length, N-term HIS tag, transcript variant a)

ELK4 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.


ELK4 Human Purified
  Abnova Taiwan Corp.


ELK4 Human Purified
  Abnova Taiwan Corp.


ELK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ELK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ELK4 (3 products)

Catalog No. Species Pres. Purity   Source  

ELK4 293T Cell Transient Overexpression Lysate(Denatured)

ELK4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ELK4 Lysate

Western Blot: ELK4 Lysate [NBL1-10234] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ELK4
  Novus Biologicals Inc.

ELK4 Lysate

Western Blot: ELK4 Lysate [NBL1-10235] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ELK4
  Novus Biologicals Inc.
  • LinkedIn