discontinued

H00022936-A01 ELL2 antibody

See related secondary antibodies

Search for all "ELL2"

Quick Overview

Mouse anti Human ELL2

Product Description for ELL2

Mouse anti Human ELL2.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ELL2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms RNA polymerase II elongation factor ELL2
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O00472
Immunogen:
ELL2 (NP_036213, 253 a.a. ~ 353 a.a) partial recombinant protein with GST tag.
AA Sequence:
SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNATGTSRSESPVCSSRDAVSSPQKRLLDSEFID PLMNKKARISHLTNRVPPTLNGHL*
GeneID:
22936
Remarks:
Gene Accession: NM_012081
Add. information Mouse polyclonal antibody raised against a partial recombinant ELL2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 22936

Accessory Products

Proteins and/or Positive Controls

Proteins for ELL2 (2 products)

Catalog No. Species Pres. Purity   Source  

ELL2

ELL2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ELL2

ELL2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ELL2 (1 products)

Catalog No. Species Pres. Purity   Source  

ELL2 Lysate

Western Blot: ELL2 Lysate [NBL1-10237] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ELL2
  Novus Biologicals Inc.
  • LinkedIn