discontinued

H00009521-B01 Elongation factor p18 antibody

See related secondary antibodies

Search for all "Elongation factor p18"

50 µl / €370.00

Quick Overview

Mouse anti Human Elongation factor p18

H00009521-B01

Product Description for Elongation factor p18

Mouse anti Human Elongation factor p18.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for Elongation factor p18

Product Category Primary Antibodies
Quantity 50 µl
Synonyms AIMP3, Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, EEF1E1, Eukaryotic translation elongation factor 1 epsilon-1, Multisynthetase complex auxiliary component p18, P18
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
EEF1E1 (NP_004271.1, 1 a.a. ~ 174 a.a) full-length human protein.
AA Sequence:
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLE YRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHY PGIRQHLSSVVFIKNRLYTNSH
Remarks:
Gene Accession: NM_004280.2
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
None
State:
Purified

Accessory Products

  • LinkedIn