H00326342-B01P EMR4P antibody

See related secondary antibodies

Search for all "EMR4P"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human EMR4P

H00326342-B01P

Product Description for EMR4P

Mouse anti Human EMR4P.
Product is tested for Western blot / Immunoblot.

Properties for EMR4P

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms EMR4, FIRE, GPR127, PGR16
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
EMR4P (AAI52959.1, 1 a.a. ~ 232 a.a) full-length human protein.
AA Sequence:
MGSRFLLVLLSGLTVLLALPGSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECET GLAKCKYKAYCRNKVGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWENLRRNGSREDFARRAT QLIQSVELSIWNASFASPGKGQISEFDIVYETKRCNETRENAFLEAGNNTMDINCADALKGNLRESTAVALSLINL LGIF
GeneID:
326342
Add. information Mouse polyclonal antibody raised against a full-length human EMR4P protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn