H00002025-B01P ENO1P antibody

See related secondary antibodies

Search for all "ENO1P"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ENO1P

H00002025-B01P

More Views

  • H00002025-B01P
  • H00002025-B01P
  • H00002025-B01P

Product Description for ENO1P

Mouse anti Human ENO1P.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ENO1P

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -, enolase 1, pseudogene
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
ENO1P (AAH46928.1, 1 a.a. ~ 388 a.a) full-length human protein.
AA Sequence:
MSILKIHARELFDSRGNPTVEVDLFTSEGLFRAAVPSGASTGIYEVLELQDNDKTRYMGKGVSKPVEPINKTIAPV LVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAACKASAVEKGVPLYHHIADLSGNSKVILPVPVFNV INGSSHAVTKLAMQEFMVLPVGAANFREAMPIGAEVYHSLKNVIKEKYGKDATGVGDGGAFAPNILENKEGLELLK TAIGKAGYTDKVIVSMDVEASEFFRSGKYDLEFKFLDDPTRYISPDCLADLYKSFIKNYPVVSTEDPFDQDDWGAW QKFTASAGIQVVEDDLRVTNPKRTASAVNEKKCNCLLLKVNQIRSVTESLQACKLAQANGWCVMVPHHSGETENTF ITDLVVGL
Remarks:
Gene Accession: BC046928
Add. information Mouse polyclonal antibody raised against a full-length human ENO1P protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human

Accessory Products

  • LinkedIn