discontinued

H00339221-B01P ENPP7 antibody

See related secondary antibodies

Search for all "ENPP7"

Quick Overview

Mouse anti Human ENPP7

H00339221-B01P

More Views

  • H00339221-B01P

Product Description for ENPP7

Mouse anti Human ENPP7.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ENPP7

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Alkaline sphingomyelin phosphodiesterase, E-NPP7, Ectonucleotide pyrophosphatase/phosphodiesterase family member 7, Intestinal alkaline sphingomyelinase, NPP-7
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWV6
Immunogen:
ENPP7 (AAH41453.2, 1 a.a. ~ 458 a.a) full-length human protein.
AA Sequence:
MRGPAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARDGVKARYMTPAFVTMTS PCHFTLVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWDNGSVPIWITAQRQGLRAGSFFYPGGNVTYQGV AVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRE SIARNHLTDRLNLIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAH PKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDMDMKTIFRAVGPSFRAGLEVE PFESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALPPDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSE VA
GeneID:
339221
Remarks:
Gene Accession: BC041453.1
Add. information Mouse polyclonal antibody raised against a full-length human ENPP7 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 339221

Accessory Products

Proteins and/or Positive Controls

Proteins for ENPP7 (2 products)

Catalog No. Species Pres. Purity   Source  

ENPP7

ENPP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ENPP7

ENPP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ENPP7 (1 products)

Catalog No. Species Pres. Purity   Source  

ENPP7 293T Cell Transient Overexpression Lysate(Denatured)

ENPP7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn