discontinued

H00008288-D01P Eosinophil peroxidase antibody

See related secondary antibodies

Search for all "Eosinophil peroxidase"

Quick Overview

Rabbit anti Human Eosinophil peroxidase

Product Description for Eosinophil peroxidase

Rabbit anti Human Eosinophil peroxidase.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Eosinophil peroxidase

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms EPER, EPO, EPP, EPX
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P11678
Immunogen:
EPX (AAI11603.1, 1 a.a. ~ 715 a.a) full-length human protein.
AA Sequence:
MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPMDLLSYF KQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAERCSDKYRTITGRC NNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPLVRAVSNQIVRFPNERLTSDRGRALMFMQWG QFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKNRVRNQINA LTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSTE TPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDFLPLVLGKARARRTLGHYRGYCS NVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQ DAMLVDELRDRLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLYGT PDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSRIICDNTGITTV SRDIFRANIYPRGFVNCSRIPRLNLSAWRGT
GeneID:
8288
Remarks:
Gene Accession: BC111602
Add. information Rabbit polyclonal antibody raised against a full-length human EPX protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 8288

Accessory Products

Proteins and/or Positive Controls

Proteins for Eosinophil peroxidase (3 products)

Catalog No. Species Pres. Purity   Source  

Eosinophil peroxidase

Eosinophil peroxidase Human Purified >95% pure by SDS-PAGE. Eosinophils
0.2 mg / €1,220.00
  OriGene Technologies GmbH

Eosinophil peroxidase

Eosinophil peroxidase Human Purified
  Abnova Taiwan Corp.

Eosinophil peroxidase

Eosinophil peroxidase Human Purified
  Abnova Taiwan Corp.

Positive controls for Eosinophil peroxidase (1 products)

Catalog No. Species Pres. Purity   Source  

EPX Lysate

Western Blot: EPX Lysate [NBL1-10306] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EPX
  Novus Biologicals Inc.
  • LinkedIn