TA346196 Eosinophil peroxidase antibody

Rabbit Polyclonal Anti-EPX Antibody

See related secondary antibodies

Search for all "Eosinophil peroxidase"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Eosinophil peroxidase

TA346196

More Views

  • TA346196

Product Description for Eosinophil peroxidase

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Eosinophil peroxidase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Eosinophil peroxidase

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms EPER, EPO, EPP, EPX
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P11678
Immunogen:
The immunogen for anti-EPX antibody: synthetic peptide directed towards the middle region of human EPX. Synthetic peptide located within the following region: LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP.
GeneID:
8288
Application WB
Background EPX belongs to the peroxidase family, XPO subfamily. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD).
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Eosinophil peroxidase (3 products)

Catalog No. Species Pres. Purity   Source  

Eosinophil peroxidase

Eosinophil peroxidase Human Purified >95% pure by SDS-PAGE. Eosinophils
0.2 mg / €1,070.00
  OriGene Technologies GmbH

Eosinophil peroxidase

Eosinophil peroxidase Human Purified
  Abnova Taiwan Corp.

Eosinophil peroxidase

Eosinophil peroxidase Human Purified
  Abnova Taiwan Corp.

Positive controls for Eosinophil peroxidase (1 products)

Catalog No. Species Pres. Purity   Source  

EPX Lysate

Western Blot: EPX Lysate [NBL1-10306] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EPX
  Novus Biologicals Inc.
  • LinkedIn