discontinued

H00057634-M01 EP400 / P400 antibody

See related secondary antibodies

Search for all "EP400 / P400"

Quick Overview

Mouse anti Human EP400 / P400 2A7

Product Description for EP400 / P400

Mouse anti Human EP400 / P400 2A7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for EP400 / P400

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CAG repeat protein 32, CAGH32, Domino homolog, E1A-binding protein p400, KIAA1498, KIAA1818, TNRC12, Trinucleotide repeat-containing gene 12 protein, p400 kDa SWI2/SNF2-related protein
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2A7
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96L91
Immunogen:
EP400 (NP_056224, 743 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLRE ERGKKEEQSRLRRIAASTAREIECFWSNIEQV*
GeneID:
57634
Remarks:
Gene Accession: NM_015409
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant EP400.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 57634

Accessory Products

Proteins and/or Positive Controls

Proteins for EP400 / P400 (2 products)

Catalog No. Species Pres. Purity   Source  

EP400 / P400

EP400 / P400 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EP400 / P400

EP400 / P400 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EP400 / P400 (1 products)

Catalog No. Species Pres. Purity   Source  

EP400 293T Cell Transient Overexpression Lysate(Denatured)

EP400 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn