discontinued

NBP1-88230 EP400 / P400 antibody

See related secondary antibodies

Search for all "EP400 / P400"

Quick Overview

Rabbit anti Human EP400 / P400

Product Description for EP400 / P400

Rabbit anti Human EP400 / P400.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for EP400 / P400

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CAG repeat protein 32, CAGH32, Domino homolog, E1A-binding protein p400, KIAA1498, KIAA1818, TNRC12, Trinucleotide repeat-containing gene 12 protein, p400 kDa SWI2/SNF2-related protein
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96L91
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAELPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEEDADDCPGDRESRKDLVLIDSLFIMDQFKAAERMNIGKPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPSL
GeneID:
57634
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 57634

Accessory Products

Proteins and/or Positive Controls

Proteins for EP400 / P400 (2 products)

Catalog No. Species Pres. Purity   Source  

EP400 / P400

EP400 / P400 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EP400 / P400

EP400 / P400 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EP400 / P400 (1 products)

Catalog No. Species Pres. Purity   Source  

EP400 293T Cell Transient Overexpression Lysate(Denatured)

EP400 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn