discontinued

H00002035-D01P EPB41 / Protein 4.1 antibody

See related secondary antibodies

Search for all "EPB41 / Protein 4.1"

Quick Overview

Rabbit anti Human EPB41 / Protein 4.1

Product Description for EPB41 / Protein 4.1

Rabbit anti Human EPB41 / Protein 4.1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for EPB41 / Protein 4.1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 4.1R, Band 4.1, E41P, EPB4.1, P4.1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P11171
Immunogen:
EPB41 (AAH39079.1, 1 a.a. ~ 720 a.a) full-length human protein.
AA Sequence:
MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNKERTSES RGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSS AETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECVVEK HAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYY LCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPA QADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQ EQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFE RTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEP EPTEAWKVEKTHIEVTVPTSNGDQTQKKRERLDGENIYIRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPE PRPSEWDKRLSTHSPFRTLNINGQIPTGEGVSTLST
GeneID:
2035
Remarks:
Gene Accession: BC039079.1
Add. information Rabbit polyclonal antibody raised against a full-length human EPB41 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2035

Accessory Products

Proteins and/or Positive Controls

Proteins for EPB41 / Protein 4.1 (6 products)

Catalog No. Species Pres. Purity   Source  

EPB41 / Protein 4.1 (transcript variant 2)

EPB41 / Protein 4.1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human
  Abnova Taiwan Corp.

Positive controls for EPB41 / Protein 4.1 (1 products)

Catalog No. Species Pres. Purity   Source  

EPB41 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

EPB41 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-EPB41 antibody (H00002035-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn