discontinued

H00002035-M01 EPB41 / Protein 4.1 antibody

See related secondary antibodies

Search for all "EPB41 / Protein 4.1"

Quick Overview

Mouse anti Human EPB41 / Protein 4.1 3D9

H00002035-M01

More Views

  • H00002035-M01
  • H00002035-M01
  • H00002035-M01

Product Description for EPB41 / Protein 4.1

Mouse anti Human EPB41 / Protein 4.1 3D9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for EPB41 / Protein 4.1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 4.1R, Band 4.1, E41P, EPB4.1, P4.1
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 3D9
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P11171
Immunogen:
EPB41 (AAH39079, 116 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQS KAETELKASQKPIRKHRNMHCKVSLLDDTVYECV*
GeneID:
2035
Remarks:
Gene Accession: BC039079
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant EPB41.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,S-ELISA,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2035

Accessory Products

Proteins and/or Positive Controls

Proteins for EPB41 / Protein 4.1 (6 products)

Catalog No. Species Pres. Purity   Source  

EPB41 / Protein 4.1 (transcript variant 2)

EPB41 / Protein 4.1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human
  Abnova Taiwan Corp.

Positive controls for EPB41 / Protein 4.1 (1 products)

Catalog No. Species Pres. Purity   Source  

EPB41 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

EPB41 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-EPB41 antibody (H00002035-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn