TA338037 EPB41L4B / EHM2 antibody

Rabbit Polyclonal Anti-EPB41L4B Antibody

See related secondary antibodies

Search for all "EPB41L4B / EHM2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EPB41L4B / EHM2

Product Description for EPB41L4B / EHM2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EPB41L4B / EHM2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EPB41L4B / EHM2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Band 4.1-like protein 4B, CG1, FERM-containing protein CG1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-EPB41L4B antibody is: synthetic peptide directed towards the middle region of Human EPB41L4B. Synthetic peptide located within the following region: AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAEL.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn