discontinued

H00001969-M01 EPHA2 / ECK antibody

See related secondary antibodies

Search for all "EPHA2 / ECK"

Quick Overview

Mouse anti Human EPHA2 / ECK 6F8

Product Description for EPHA2 / ECK

Mouse anti Human EPHA2 / ECK 6F8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for EPHA2 / ECK

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Eph receptor A2, Ephrin type-A receptor 2, Epithelial cell kinase, Tyrosine-protein kinase receptor ECK
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 6F8
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P29317
Immunogen:
EPHA2 (AAH37166, 204 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPG FFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT
GeneID:
1969
Remarks:
Gene Accession: BC037166
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant EPHA2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1969

Accessory Products

Proteins and/or Positive Controls

Proteins for EPHA2 / ECK (12 products)

Catalog No. Species Pres. Purity   Source  

EPHA2 / ECK

EPHA2 / ECK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

EPHA2 / ECK (C-term DDK/His tag)

EPHA2 / ECK Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

EPHA2 / ECK (C-term DDK tag)

EPHA2 / ECK Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

EPHA2 / ECK

EPHA2 / ECK Human Purified
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human Purified
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human
  Abnova Taiwan Corp.

EPHA2 / ECK

EPHA2 / ECK Human
  Abnova Taiwan Corp.

Positive controls for EPHA2 / ECK (2 products)

Catalog No. Species Pres. Purity   Source  

EPHA2 293T Cell Transient Overexpression Lysate(Denatured)

EPHA2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

EPHA2 293T Cell Transient Overexpression Lysate(Denatured)

EPHA2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn