discontinued

H00002087-A01 ERVK2 antibody

See related secondary antibodies

Search for all "ERVK2"

50 µl / €290.00

Quick Overview

Mouse anti Human ERVK2

H00002087-A01

Product Description for ERVK2

Mouse anti Human ERVK2.
Presentation: Serum
Product is tested for Enzyme Immunoassay.

Properties for ERVK2

Product Category Primary Antibodies
Quantity 50 µl
Synonyms Putative HERV-K_Xq28 provirus ancestral Pol protein
Presentation Serum
Reactivity Hu
Applications E
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
ERVK2 (AAB63112, 88 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
AA Sequence:
PQGMLNSPTICQTFVAQVLQPVRDKFSDCYIIHYVDDILCAAETRDKLIDCYTFLQTEVANAGLTIASDKIQTSTP FHYLGMQVEERKIKPQKVEIRKDTLRTLNDFKNC*
Remarks:
Gene Accession: U87589
Add. information Mouse polyclonal antibody raised against a partial recombinant ERVK2.

Antibody Reactive Against Recombinant Protein.
Application ELISA
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn